PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gh_A12G2206
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family Trihelix
Protein Properties Length: 790aa    MW: 85874.5 Da    PI: 5.7632
Description Trihelix family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gh_A12G2206genomeNAU-NBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1trihelix95.93.7e-3089173187
     trihelix   1 rWtkqevlaLiearremeerlrrgklkkplWeevskkmrergferspkqCkekwenlnkrykkikegekkrtsessstcpyfdqlea 87 
                  rW++qe+laL+++r++m+ ++r++  k+plWe+vs+k++e g++rs+k+C+ek+en++k+yk++ke++ +r++++s  +++f+qlea
  Gh_A12G2206  89 RWPRQETLALLKIRSDMDATFRDATVKGPLWEDVSRKLAELGYKRSAKKCREKFENVHKYYKRTKETRAGRQDGKS--YKFFSQLEA 173
                  8*********************************************************************866665..*******85 PP

2trihelix1093e-34530615187
     trihelix   1 rWtkqevlaLiearremeerlrrgklkkplWeevskkmrergferspkqCkekwenlnkrykkikegekkrtsessstcpyfdqlea 87 
                  rW+k evl+Li++r+ +e+r++++  k+plWee+s+ m++ g++rs+k+Ckekwen+nk++kk+ke++kkr +e+ +tcpyf+ql+a
  Gh_A12G2206 530 RWPKAEVLTLINLRSGLESRYQEAGPKGPLWEEISAGMSRLGYKRSAKRCKEKWENINKYFKKVKESNKKR-PEDAKTCPYFHQLDA 615
                  8*********************************************************************8.99999********85 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM007170.004886148IPR001005SANT/Myb domain
CDDcd122035.76E-2888153No hitNo description
PROSITE profilePS500906.66788146IPR017877Myb-like domain
PfamPF138377.5E-2188174No hitNo description
SMARTSM007170.042527589IPR001005SANT/Myb domain
PROSITE profilePS500906.679529587IPR017877Myb-like domain
PfamPF138371.1E-23529616No hitNo description
CDDcd122032.39E-31529594No hitNo description
Sequence ? help Back to Top
Protein Sequence    Length: 790 aa     Download sequence    Send to blast
MQQEGGGGGG GGQQSQYGEM TTGPPTTGAV SEASEQLVEA ASPISSRPPA GNLDEFMRLA  60
SVGGGDELGL GDRHGSGGGG GAGVASGNRW PRQETLALLK IRSDMDATFR DATVKGPLWE  120
DVSRKLAELG YKRSAKKCRE KFENVHKYYK RTKETRAGRQ DGKSYKFFSQ LEALQTTSGA  180
APANLSIPVI PATVAVTAAS LDVAPVSVGI RMPISSAARI VPPTTAVPMS SSSFLSMPGS  240
ALAPVPVAVP EPAMAPAPAP PAATTAAPFG ISFSSNSSTF SQGFDDDEED EDEVGVGGEP  300
SSMAGTSRKR KRSSSRGGGG STTRRMMEFF EGLMKQVMQK QETMQQRFLE AMEKREQDRT  360
IREEAWKRQE MARLTREHEL MAQERAIAAS RDAAIVSFLQ KITGQTIQLP TTATVIVPAP  420
APPPPPPPTQ PTVSVVPPEV PIAPPSHQTP SLTQQKQQEQ QQTHISHHQP PPPQQQPQVV  480
QQQQQLHNME LVRHQQQPIT TEIVMAIPEQ QVPPQEISGS GSLVEPASSR WPKAEVLTLI  540
NLRSGLESRY QEAGPKGPLW EEISAGMSRL GYKRSAKRCK EKWENINKYF KKVKESNKKR  600
PEDAKTCPYF HQLDALYRKK ILGGGTSSGS FSDHNRPDEE TSRQHHDPTL STAAPQPSQN  660
ETGATADVVT SKEGLPSHPF GEGNGGAAKK PGSTVRELME EQREGLHHQQ HHHRGQSLLV  720
DGYGRIDEPD SDIMDQEVDE DDDEEDNDDD DDEELEEERK MGYKIEFQRQ NSNTPNGGGN  780
GAPSFFTMVQ
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Ghi.30650.0boll| ovule
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012439901.10.0PREDICTED: trihelix transcription factor GTL1-like isoform X1
SwissprotQ391173e-70TGT2_ARATH; Trihelix transcription factor GT-2
TrEMBLA0A0B0PVH30.0A0A0B0PVH3_G
STRINGSb01g049740.11e-155(Sorghum bicolor)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM62262746
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G33240.12e-55GT-2-like 1